Query Sequence
>Pf1N1B4_1239
MNVPENAPTSLASQLKLDAHWMPYTANRNFQRDPRLIVAAEGSWLTDDKGRKVYDSLSGLWTCGAGHTRKEIQEAVAKQLGTLDYSPGFQYGHPLSFQLAEKITDLTPGNLNHVFFTDSGSECADTAVKMVRAYWRLKGQATKTKMIGRARGYHGVNIAGTSLGGVNGNRKLFGQAMMDVDHLPHTLLASNAFTRGMPEQGGIALADELLKLIELHDASNIAAVFVEPLAGSAGVLVPPQGYLKRLREICDQHNILLVFDEVITGFGRTGSMFGADSFGVTPDLMCIAKQVTNGAIPMGAVIASSEIYQTFMNQATPEYAVEFPHGYTYSAHPVACAAGLAALDLLQKENLVQSVAEVAPHFENALHGLKGSKNVIDIRNYGLAGAIQIAPRDGDAIVRPFEAGMALWKAGFYVRFGGDTLQFGPTFNSKPQDLDRLFDAVGEVLNKID
Hit FamilyFIG00001350
Hit Family FunctionOmega-amino acid--pyruvate aminotransferase (EC 2.6.1.18)


back to search