Query Sequence
>Pf1N1B4_1173
LTKPAILALADGSIFRGEAIGADGQTVGEVVFNTAMTGYQEILTDPSYAQQIVTLTYPHIGNTGTTPEDAESDRVWSAGLVIRDLPLVASNWRNTMSLSDYLKANNVVAIAGIDTRRLTRILREKGAQNGCIMAGDNISEEAAIAAAQGFPGLKGMDLAKVVSTKEKYEWRSTVWDLKTDSHATLEASELPYHVVAYDYGVKVNILRMLVERGCRVTVVPAQTPAAEALALKPDGVFLSNGPGDPEPCDYAIQAIKDVLETEIPVFGICLGHQLLALASGAKTLKMGHGHHGANHPVQDLDSGVVMITSQNHGFAVDEATLPGNVRAIHKSLFDGTLQGIERTDKSAFSFQGHPEASPGPNDVAPLFDRFINEMAKRR
Hit FamilyFIG00000130
Hit Family FunctionCarbamoyl-phosphate synthase small chain (EC 6.3.5.5)


back to search