Query Sequence
>Pf1N1B4_1046
MSEVRHSRVIILGSGPAGYSAAVYAARANLKPLLITGMQAGGQLTTTTEVDNWPGDVHGLTGPALMERMKEHAERFETEIVFDHINAVDFAAKPYTLIGDSATYTCDALIIATGASARYLGLPSEETFMGKGVSACATCDGFFYRNKPVAVVGGGNTAVEEALYLANIASTVTLIHRRETFRAEKILIDKLNARVAEGKIVLKLNSTLDEVLGDNMGVTGARLKNNDGSFDELKVDGVFIAIGHTPNTSLFEGQLTLKDGYLVVQGGRDGNATATNLEGIFAAGDVADHVYRQAITSAGAGCMAALDAERYLDDLQNA
Hit FamilyFIG01955919
Hit Family FunctionThioredoxin reductase (EC 1.8.1.9)


back to search