Query Sequence
>Pf1N1B4_1023
MELYTYYRSTSSYRVRIALALKGLDYQALPINLIAPQGGEHRQPTYLGINPQGRVPALRTDEGELLIQSPAIIEYLEERYPQVPLLSKDLVARAHERGVAAVIGCDVHPLHNVSVLNQLRQLGHDEPQVVEWIGHWISQGLATVEQLIGDTGYCFGDQPGLADVYLIPQLYAAERFNISLEAYPRIRRVAALAATHPAFFLAHPANQPDTP
Hit FamilyFIG00004671
Hit Family FunctionMaleylacetoacetate isomerase (EC 5.2.1.2) @ Glutathione S-transferase, zeta (EC 2.5.1.18)


back to search