Query Sequence
>Pf1N1B4_1020
LTRLYRQMVLTRLFDQKAVALQRTGRIGTYAPTLGQEAIGVAVGSLMHAEDVLIPYYRDTAVQLMRGVRMEEILLYWGGDERGSDFADPAVAQDFPICVPIATQALHACGVASAFKIRGEHRVAVTTCGDGGTSKGDFLEALNVAGAWQLPVVFMVNNNQWAISVPRRIQCGAPTLAQKAIGAGFHGEQVDGNDMLAVYDRVQAALERTRHGKGPVLLECLSYRLGDHTTADDATRYRSADEVKQAWLEEPIKRLQRFMAGQGVWDEGREQALISECQGLVQRAVDNFEAAGLQAPESVMDHVYAQWPQALAEQREDFLERVARRTGGSSDE
Hit FamilyFIG00000964
Hit Family FunctionBranched-chain alpha-keto acid dehydrogenase, E1 component, alpha subunit (EC 1.2.4.4)


back to search