Query Sequence
>PP_4825
MLHELFSVYLKMLVLYSPFFVLSCFISLTRGHSSKERKQLAWKVAFAALVASVLLYLFGRAIFGIFGITADAFRIGAGSVLFISALGMAQGKPAVQADNVQQDVTIVPLTIPLTVGPGTIGALLVMGVSQPHWDEKLLAIVSIALASFTVGLVLYLSHGIERLLGDQGLQIVSRLMGLFVCALAAQIIFTGIRGYLLP
Hit FamilyFIG00955051
Hit Family Functionmembrane protein, MarC family


back to search