Query Sequence
>PP_4640
MFNDLGRLGKYLGQAARLMVGMPDYDNYVEHMQKTHPDKPVMSYEAFFRERQEARYGGKSGPKCC
Hit FamilyFIG00732160
Hit Family FunctionCOG2879, Hypothetical small protein yjiX


back to search