Query Sequence
>PP_4632
MLGGNQRTDKLTTPNMNSPILVTGASQRVGLALALELAQAGHTVVSASRSIQPQAAHPNIVQFQADLCQAGDRQALIDHLHDRYDGLRAIIHNASLWLDDGLDNLETMFRLHVEAPYHLNLALGDLLAKVEKADIIHICDETSSRGSKSHIGYAATKAALQNMVLSFAEKYAPKVRVNGILPGLLILKEGGDDAYRQQTLKKALLEFEPGAGPLIETVKYLLASQYSTGSQVVINGGRHLKNRMT
Hit FamilyFIG00138402
Hit Family FunctionFolM Alternative dihydrofolate reductase 1


back to search