Query Sequence
>PP_3595
MSFDQLLAMVLDPDLLERYGPRFIDGLLVTAKLVAISFSLGAVLGLLLALARLSRSLVLQRMAAGYVYFFRGSPLLAQLFLLYYGLGSLKGFWQDVGLWWFFRDAWFCTLLAFTLNTAAYQAEIFRGSLMAVAPGQHEAARALNLKRSTTFFKVILPQSLLVAIGPLGNELILMIKASAIASLVTIYDLMGVTKLAFSRSFDFQIYLWAAVLYLVIVELVRRLLKHLEARLGRHLN
Hit FamilyFIG01322745
Hit Family FunctionAmino acid ABC transporter, permease protein


back to search