Query Sequence
>PP_3276
MHKEALIPYLLLLGDSALVQGQRLCEWCGRAPAIEEELALMNVGLDLVGQARNWLEYAAELLDDGRDADALAFRRDERAYRNLLLVEQPNGDFAVTMTKQFLYDAWHFAVLQGLVESSDARIAGIAAKALKEVTYHLRRSSEWVQRLGGGTDASRQRMLAAVPALWRFTVELAAGSDNEVRLAECGIAADPATVGATWLKQVAATFASVELPLPKAASHFYLDGRKGLHTEHLGLLLAEMQFLPRAYPDATW
Hit FamilyFIG00001825
Hit Family FunctionPhenylacetate-CoA oxygenase, PaaI subunit


back to search