Query Sequence
>PP_2768
MAFFFEVLIGGLLAGVMYSLVAIGFVLIYKASGVFNFAQGAMVLFAALTFVSLLERGVPFWLSFLVTLATMIALALLIERAVLRPLVGRSPITLFMATLGLAYIIEGAAQALWGAQVHGLELAISDAPLELGGLLLSQFDLFAAATAAALVVLLSLLFNRTRIGLALRAVADDPRAAMSVGIRLPRVWAVVWAVAGFVGLVAGLLWGARLGVQFSLSLVVLKALPVLIIGGFTSISGAIVGGLIIGASEKLAEVYFGPLIGGGIENWFPYVLALLFLLVRPAGLFGERAIERV
Hit FamilyFIG00003435
Hit Family FunctionHigh-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)


back to search