Query Sequence
>PP_2723
MSDYPTPPFPSQPQSVPGSQRKMDPYPDCGEQSYTGNNRLAGKIALITGADSGIGRAVAIAYAREGADVAIAYLNEHDDAQETARWVKAAGRQCLLLPGDLAQKQHCHDIVDKTVAQFGRIDILVNNAAFQMAHESLDDIDDDEWVKTFDTNITAIFRICQRALPSMPKGGSIINTSSVNSDDPSPSLLAYAATKGAIANFTAGLAQLLGKQGIRVNSVAPGPIWTPLIPATMPDEAVRNFGSGYPMGRPGQPVEVAPIYVLLGSDEASYISGSRYAVTGGKPIL
Hit FamilyFIG00445780
Hit Family FunctionOxidoreductase, short chain dehydrogenase/reductase family


back to search