Query Sequence
>PP_2255
MLKWCSRSIFLQVVLGLALGIACGLSFPDLSLQLKPLGDGFIKLIKMLIGLIVFCVVVSGISGAGDLKKVGRIGLKSVIYFEVLTTLALVIGLVFAFTSGIGSGANIHLDQLSAADANGLAERGQHIHGATAFFMDLIPTSVIGAFADNNILQVLLFSVLFGSALNLVGDSAAGISRLINELSHVIFRIMGMIVRLAPIGVFGAIAFTTSKYGLASLQHLGGLVALFYLTCAGFVLIVLGTVMRLSGLKLLPLIKYLREELTIVLGTASSDAVLPQIMRKLEHLGIGSSTVGLVIPTGYSFNLDGFSIYLTLAIVFIANATGTPLEMTDLLTILLVSLVTSKGAHGIPGSALVILAATLTAVPAIPVVGLVLVLAVDWFMGIGRALTNLIGNCVATVAIARWEKDIDLERAQNVLDGKPGFAPTPRKQPSAHQQEF
Hit FamilyFIG01349419
Hit Family Functionprobable dicarboxylate transporter


back to search