Query Sequence
>PP_2179
MPRVPVIGITACTSMIELHATQTISEKYARAAAKAACGLPIVIPSLGELMDSADILDVVDGLIFTGSPSNIEPYHYNGPASAAGTHHDQLRDATTLPLMRAAIAAGVPVLGICRGFQEMNVALGGTLHQKVHETGVFMDHREGKDEPLDKQYGPRHTLHVEPGGMLDRMGLPAIFDVNSIHGQGIDVLAPGLRVEALAPDGLVEAISVESSKGFALGVQWHPEFQVMDNPHYLAIFQSFGKACRHRSVLRQRLLLSA
Hit FamilyFIG00007600
Hit Family FunctionGamma-glutamyl-GABA hydrolase (EC 3.5.1.94)


back to search