Query Sequence
>PP_1946
MTVNYDFSGKVVLVTGAGSGIGRATALAFAQSGASVAVADISTDHGLKTVELVKAEGGEATFFHVDVGSEPSVQSMLAGVVAHYGGLDIAHNNAGIEANIVPLAELDSDNWRRVIDVNLSSVFYCLKGEIPLMLKRGGGAIVNTASASGLIGGYRLSGYTATKHGVVGLTKAAAIDYANQNIRINAVCPGPVDSPFLADMPQPMRDRLLFGTPIGRLATAEEIARSVLWLCSDDAKYVVGHSMSVDGGVAVTAVGTRMDDLF
Hit FamilyFIG01345757
Hit Family Functionoxidoreductase, short chain dehydrogenase/reductase family


back to search