Query Sequence
>PP_1742
MNDSIYLSIQNSPRFKELVTKRERFAWILSAIMLGLYCAFILLIAYGPHVLGAKLSPESSITWGIPLGVGLIVSAFVLTAIYVRRANGEFDELNKEILKEAQQ
Hit FamilyFIG00001462
Hit Family FunctionPutative membrane protein, clustering with ActP


back to search