Query Sequence
>PP_1017
MHSPVDKPVLSLSRMAIHAVLLIAVLLYLVPLVVMLLTSFKTPEDITTGNLLSWPAVITGIGWVKAWGAVSGYFWNSIMITVPAVLISTAIGALNGYVLSMWRFRGSQLFFGLLLFGCFLPFQTVLLPASFTLGKLGLASTTGGLVLVHVVYGLAFTTLFFRNFYVSIPDALVKAARLDGAGFFTIFRRIILPMSTPIIMVCLIWQFTQIWNDFLFGVVFSSGDSQPITVALNNLVNTSTGAKEYNVDMAAAMIAGLPTLLVYVVAGKYFVRGLTAGAVKG
Hit FamilyFIG00143114
Hit Family FunctionGlucose ABC transport system, inner membrane component 2


back to search