Query Sequence
>PP_1003
MSEPGQKLRLGALIALVVGSMIGGGIFSLPQNMAARADVGAVLIGWGITAVGMLALAFVFQTLANRKPELDSGVYAYAKAGFGEYMGFSSAWGYWISAWLGNVGYFVLLFSTLGFYFPVFGEGNTPIAIGCASLLLWSVHFLVLRGIKEAAFINQVTTVAKVVPLLIFVVIAAFAFRADIFTRDIWGLSNPQFGSVLEQVRNMMLVTVFVFIGIEGASVYSGRAQRRSDVGKATVIGFLGVLALLVLVNVLSLGIMTQPELAGLQNPSLASVLEHIVGPWGALLISLGLAVSLLGALLSWALLCAEILYATARDKTMPRFLAKENANHVPANALWLTNCMIQGFLLITLFSAGTYTSLIYLASSMILVPYLWSAAYAVLLAMRAETYAGQPRLRRKDLLVALVALLYAVWLLYAGGLKYLLLSALLYAPGVILFARAKHEQGQTLFTAWEKLIFAAVLVGAALAAYALYSGLLSL
Hit FamilyFIG00001166
Hit Family FunctionArginine/ornithine antiporter ArcD


back to search