Query Sequence
>N515DRAFT_4210
MSSTSSAKTLLADLGGTNVRFALADPALPQPLLLDSVRRYRVKDFPSMADTIRQYFADSGLSAGRAVIAAAGRIVDGETVKVTNNPWQVSAHGLAADLKFDSVRLINDFAAQGMAVPLLACNELQPVGAPQPPKIGAHHSQTFVVVGPGTGLGVAGLLLRDGRWTVLETEGGHAGFAAHTAEDVEILHRLNARFGRVSNERMICGNGLVNLYLALADIEGLKAEEYTPEDITTRANAGTDPLCVRTVETLAGIFGSVAGDLVLSLGGWDGVFLTGGVLPILLPWLQHGGFRERFESKGRFKETMEQVPTVAMMHAETGLLGAAAFAVLESGRPLVPAAG
Hit FamilyFIG00001065
Hit Family FunctionGlucokinase (EC 2.7.1.2)


back to search