Query Sequence
>N515DRAFT_3488
MSHFASVEMTPGDPILGLTEAYLADARPGKVNLGVGIYYDEQGRIPLLRAVHEVEQRLAQEAKPRGYLPIDGLPAYTQGTQKLVFGAESPLLAAGRVATSQTIGGSGALRVGADVLKKALPKAKIAISNPSWENHRVVFIAAGFEVVEYTYYDPQTHGLDFAGMLADLGKLEPGTVVLLHACCHNPTGVDLNAAQWQQVVEVVKERQLLPFIDMAYQGFDQGIDADATAVRLFAASGIESFVVTSSYAKSFSLYGERAGALTFVAADRDEALRVQSLVKRTIRSIYSSPSTHGGALVAGVLNSPELRAMWEQELGEMRERIHAMRAGMVEKLAAHGAPQFAFIQQQAGMFSYSGLSKAQVDRLRDEYAIYAIGTGRICVAALNRSNLDTVAAAVAAVSKA
Hit FamilyFIG00094525
Hit Family FunctionAromatic-amino-acid aminotransferase (EC 2.6.1.57)


back to search