Query Sequence
>N515DRAFT_3479
MLTLYDYLPSQNGWKVRQLLRHLDLPYRTVPVSIFEGEGRQPGYLRINPTGTVPAIALEDGRTLAESNAILAYLAEGTPYLPGDAYGRAKVLQWLNFEQERVESVIGSLRYWTLTGQLAKRGPALVELKREAGLRALSMLDAELGTRPFVASESYGIADIALFAYASRADEAGFDLAPYSHFQAWIERVRAQPGHLAKTFPYSVDPHAPR
Hit FamilyFIG00136635
Hit Family FunctionGlutathione S-transferase, unnamed subgroup (EC 2.5.1.18)


back to search