Query Sequence
>N515DRAFT_3220
MKRGVLVAGSANLDFVVRAAHVPAPGETVLGRGFATFPGGKGANQAVACARAGGAPTRMLLALGDDAHAAPIEASLRAAGVGLDAVRMRGESSGVAFVCLADDGENAITVAPGANAALRPDHLPPLAGVSHLLLQLETPLPTVKAWARVACRAGIHVALNAAPAQALPRSLLDDCQLLIVNEGELAAITGEHDITAGLDALDVAAVVVTLGARGCCARVGSQYLLQPGFAVDAIDTTGAGDTFCGVLVAGLSLGLAYPAALRRASAASALACTRLGAQAGVPGYEQVQRLLAVRPADATEALAAYVGFA
Hit FamilyFIG00028476
Hit Family FunctionRibokinase (EC 2.7.1.15)


back to search