Query Sequence
>N515DRAFT_3073
MATTAMGAANIGTGHRRVILASSLGTVFEWYDFYLYGSLAVLIGKHFFSGLNETSAFIFALLAFAAGFAVRPFGAIVFGRLGDLVGRKYTFLITIIIMGLSTFLVGVLPSYSTVGMIAPVLLIVLRLLQGLALGGEYGGAATYVAEHAPDGKRGLYTSFIQITATFGLFLSLLVILGTRMALGDKVFEDWGWRIPFLISSVLVAVSVYIRLQLQESPVFQQMKAEGKHSKAPLTEAFGHWKNLKVVILALLGATAGQAVVWYTGQFYALYFLTQSLKIDGTTANLLIAAALIIGTPFFVFFGWLSDRIGRKSIVLAGCLLAALTYFPIFKGLTHFGNPAIETAAASAPVTVIADPNACSFQFDPVGKSKFTSSCDVAKTVLAKKGIPYRNEAAPAGAVAQVTIGTGTIESFEGGGLDSATFAAQSKAFGTKIGDALKAAGYPEKADPAQRNDVMLVILLAILVLYVTMVYGPIAAWLVEMFPTRIRYTSMSLPYHIGNGWFGGFVPTIGFMLVAWKGDIYYGLWYPIIVAVGTFFIGLLFLKETKDVNITT
Hit FamilyNo hits found for this sequence


back to search