Query Sequence
>N515DRAFT_1217
MLLYERLAGSLRGQIARGALRAGERLPSIRQLALGHGLSAATAVQACLQLEREGLVVARPRSGYYVRAAVPPPPAAKPPRRRVPGAVNNPALQEVLDMLARSDVLPLHSATPSPALLPQAALTAALSRSLRHHPAAVLDYAPPQGLPALRRQIARRYAQLGAAVSPDEIVITAGAMEGISLALRTLAEPGDVVLVETPTYHGILQAVAALRLKVLEVPNLPGQGIDVARLDQLLQQNRVRAAVLVPNFNNPLGSVTGDAAKQALLASCARHGTVVIEDDVYGDLAWSGERPSPLRRWDTRGNLISCGSFSKSLSPGLRLGWIAAGAWTDALVRAKYFSTVGAASLPQLAMAEYLQKHDLERHLRRLRRALADNAQRLHEAISRHWPAGTRASEPRGGLSLWLQLPEGGDGQMLFEAALEQGIGTSPGVLFSSRGDYGDCLRLSCGMPWDARLEQALKKLGQLAARQLA
Hit FamilyFIG00005520
Hit Family FunctionTranscriptional regulator, GntR family domain / Aspartate aminotransferase (EC 2.6.1.1)


back to search