Query Sequence
>N515DRAFT_0959
MHTIDVIDSHTGGEPTRTVIAGFPDLGAGTLMEQRERFRRDFDRWRAGIACEPRGSATVVGALLLPPQSADACAGVIFFNNVSYLGMCGHGTIGVVRTLQHMGRIGPGLHRIETPVGTVGAELHADGRVSIDNVESYRHAKDVQVSVPGYGEVTGDIAWGGNWFFITKDTPLPLDIGHQRELTAYTEAIRRVLEAQGITGAEGGEIDHIEINADLPGKAGRNFVLCPGLAYDRSPCGTGTSAKLACLAADGKLAPGEVWRQESILGEGSEFEATYTLGARGVKPRITGSAYVVARSTLLFDEADAFTWGSGAE
Hit FamilyFIG00023542
Hit Family Function4-hydroxyproline epimerase (EC 5.1.1.8)


back to search