Query Sequence
>HSERO_RS23190
VNKVYPDAATALKDIVKDGQTIAVGGFGLCGIPEALIAALRDSGVQNLTAISNNAGVDGFGLGQLLTTRQIKKMIASYVGENKEFERQYLAGELELEFTPQGTLAEKLRAGGAGIPAFFTKTGVGTLVAEGKEVREFDGERYVMERSLVADVSLVKAHKADKAGNLVFNKTARNFNPNVAMAGKVTVVEVEELVEVGQLDPDQIHTPGIFVHRIVVNATPEKRIEQRTVRA
Hit FamilyFIG00133228
Hit Family FunctionSuccinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (EC 2.8.3.5)


back to search