Query Sequence
>HSERO_RS23030
MMGGFSWTYFFFMVQSIGWTLVLSALAFVLGGAGGFLVMLARISPHAWLRRPAILFIECVQGIPLLILLFIVYFGLSVYGLVLPALVAAGLAMMIYTSAYLGDIWRGCVEAMPRPQWEASECLSLTRWQTLRLVIIPQATRLSLPPTIGFLVQLIKMTSLASVIGFVELTRAGQIINNSIFQPFLVFLLVGSFYFLLCYPLSRWSASMERKLNVSHR
Hit FamilyNo hits found for this sequence


back to search