Query Sequence
>HSERO_RS22275
MQDLPSRRDFLRRSGQLALSLGAAMHLPHALAQADAYPHSSGSQRAASRLPDDACDCHMHIYDPRFAWAPGAKLVHAPATVAMYRQLQQRLGTTRNVVVTPSAYGVDNSCTLDALAQLGRSARGVAVVNDQVSDAELQRLHQAGVRGLRFNLAVGSVTTVEMMEPLARRMAPLGWHLQANMPNEVLLAHRAMLARLPVPLVFDHFARIPLQADATHPVFDFVTGLMRERRASVKLSGAYLYSKRGAPDYDDVAPLARALVQLAPTQLVWGSDWPHPTEQHKPDDARLLDVMISWLGSEEMVRTVLVANPARLYQF
Hit FamilyFIG01492514
Hit Family Functionputative 2-pyrone-4,6-dicarboxylic acid hydrolase


back to search