Query Sequence
>HSERO_RS21785
MTRFIRAALLAGLTALSLSLSLSPALADDAAAAPASRLDQVIKAGKLRICMTGDYKPFTYYRPDQSFEGMDVELGQALAKSLGVEAQFIKTTWSNLMNDFIAQCDIAMGGVSITLDRARKAAFSEPTMVDGKAPIIRCADKDKFRNFDMIDQPGTRAIVNPGGTNERFARARYKRATLTLHPDNVTIFQQIVDGKADVMVTDASETLWQSKLHPELCPVTPDQPLQFAEKAYLLPRGDVAFKAYVDTWLHLAKATGEYQQIFDKWLK
Hit FamilyFIG00132808
Hit Family FunctionCyclohexadienyl dehydratase (EC 4.2.1.51)(EC 4.2.1.91)


back to search