Query Sequence
>HSERO_RS20230
MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMNPYGQVPILVERDLVLYESNIINEYIDERFPHPQLMPADPLMRARARLMLFNFEKELFVHVHTLENEKSKAAEKSQEKARNEIRDRLTQLAPLFLKNKYMLGDEFSMLDVALAPLLWRLDHYGIELSKTAAPLMKYAERIFSRPAYIEALTPSEKVMRR
Hit FamilyFIG00001437
Hit Family FunctionStringent starvation protein A


back to search