Query Sequence
>HSERO_RS19995
MKRFTREEIAARVAQDIPEGAYVNLGIGLPTKVANYLPADKEIFLHSENGVLGMGPAPAPGEEDEDLINAGKQPVTLLTGGAYFHHADSFAMMRGGHLDICVLGAFQVSAKGDLANWHTGAPDAIPAVGGAMDLAIGAKQVFVMMDHQTKTGESKLVEACSYPLTGIGCVNRIYTDLAVIDVTPHGLQVREIVEGLSFDELQKLTGAPLRPAA
Hit FamilyFIG00002102
Hit Family Function3-oxoadipate CoA-transferase subunit B (EC 2.8.3.6)


back to search