Query Sequence
>HSERO_RS19345
MSAIVKIKDLHKSFGSNKVLNGVSLDVQKGQMVAIIGKSGSGKSTLLRCLNGLEKVDAGDIQVCGHDIHHPDKLNLRELRKQVGIVFQSYNLFPHLTVERNITLALTTIKKMSTEQAKTIAHKVLQLVGLENKKDAYPEQLSGGQAQRVAIARSLAMAPELMLFDEVTSALDPELTAEVLKVMEDLARGGMTMVLVTHEMAFARKLADVLVFMHQGQVWEIGPPDELFSHPKTAELQKFVSSDL
Hit FamilyFIG00006151
Hit Family FunctionMethionine ABC transporter ATP-binding protein


back to search