Query Sequence
>HSERO_RS19255
MKLLKLAGVLVGASVLMSSVHAEEFTGRLKKIKDSGTLTLGVRDSSIPFSYLDDKQSYQGYSIDLCLKAATAIQKKLGLTSLNIKMVPVTSATRIPLIANGTTDISCDSATNNQERWNQVAFSVTEFVTANKFLSKKAANLKTLEDLKGKTVVSTSGTSNLKQITALNAERNLGMNILAAKDHAEAFLMVETGRAAAFVMDDILLSSLAANSKAPGDYQVSSEALSVEPYGLILPKGDKEFKTVVDDALTVVYKGDDIKKIYAKWFQSPIPPKGVNLNVPMSPQLQAVLAKPTDSYDPAAYAVVPEAQKNMGKKK
Hit FamilyFIG00001171
Hit Family FunctionGlutamate Aspartate periplasmic binding protein precursor GltI (TC 3.A.1.3.4)


back to search