Query Sequence
>HSERO_RS18425
VFKKVVIFGVGLIGGSFALALRRAGQAAHIVGVGRSLQSLERARELGIIDAVATDAASAVQGADLILVAAPVAQTGPILASIAPHLEPQAIVTDAGSTKSDVVAAARMALGDRIVQFIPAHPIAGREKHGPEAALAELYEGKKVVITALPENDAADVEIVAAAWRACGAVIHRLSPQEHDAVFASVSHLPHVLAFALVDDIAAKPHAATLFQYAASGFRDFTRIAASSPEMWRDITLANRDALLTEVDAYLLQLQNIRAMIAAGDGPGIEKIYASAQHARQQWAAAIEAAERKAS
Hit FamilyFIG00018141
Hit Family FunctionCyclohexadienyl dehydrogenase (EC 1.3.1.12)(EC 1.3.1.43)


back to search