Query Sequence
>HSERO_RS17240
MAQPRKVIITCAVTGAIHTPSMSPYLPVTPEQIRDEALAAAEAGAAIVHLHARDPGNGKPTQDPDAFRKFLPQIKARSNVVINLTTGGAPTMGVEERLQPALQLKPEVASLNMGSMNFGLYEMLNRFKDFKYDWEQPYLAGSDDRIFRNTFKDIAYILESCSANQTRFEIECYDIGHLYTAAHFIDRGLIKPPFLIQSVFGLRGGIGNDVEDVMHMKRTADRLFGQDYFWSVLGAGRGQIPIATMAAAMGGHTRVGLEDSLWDGPGKLARSNADQVRRIRTVIEALSLEVASPEDARAMLKLKGGDQVGF
Hit FamilyFIG00989364
Hit Family Functionhypothetical protein AF1210


back to search