Query Sequence
>HSERO_RS15495
MKRLPSSVLPWLLLSPAMVLLIAFTHYPALATLWHSFFSTPKGVRPSVFVGLENYRLMADDPVFWQALCNNLWFALGTIPLAIALAILMALWVNEKLAGRGVLRLAYFTPTVLPMIAVANIWLFFYTPQYGLLEQITGALGLPSHNWLGNPQTVLGALMVVAVWKEAGFFMIFYLAALQQISPVLAEAAALEGASRWQYFWRVQFPLLMPTTLFVLINALINAFRLVDHIVVMTKGGPDNASSLLLYYIYEVGFAFWDSSYAAALTVVLLALLGLIALVKFRVLDRRTHYQ
Hit FamilyFIG00007586
Hit Family FunctionMultiple sugar ABC transporter, membrane-spanning permease protein MsmF


back to search