Query Sequence
>HSERO_RS13395
VLNESQRQQAADLLWDCWAHNRRIGQLPPPLQPADRQQAYDIQARLEARSFAPLAGWKIGATGPGGQQLLNVDGPMAGRLLAERMHRNGAHVTLGDNLMSVIEAEVVFRMRSALPPRTQPYSQEEVMEAVGSVHPGIEIPDTRYQQFREVGAYQLIADNCCADQFVLGAPTSMDWRHLDLAALATSAFIEGGEQRSGSGAQVLGDPRIALTWLVNELRQHGLTLAAGQLVATGSTIVPMPVQAGQTVRADLGVLGSVTVHLT
Hit FamilyFIG01304357
Hit Family Function2-keto-4-pentenoate hydratase (EC 4.2.1.80)


back to search