Query Sequence
>HSERO_RS08570
MPFAISDQRKIHYQVEGEGPPLLLHHGFTSSLEAWRFFGFTDVLRQHYRVISFDALGHGQSDKPHDSAAYSQHQRCRDALAVLDAAQVERTHFFGYSLGGWVGYGLVRQAPERLRSLILGAAHPYEDRSWEVFRGIDGTDPEAFIAAFEDLLDEAISPQVKMLIRGNDLVALAAAAQQARPSQEELLARMDLPCLFFCGDADARHTAVARTAARLARAEFVSLPGVTHFGGLMQSALVLPPVLDFLGRLPG
Hit FamilyFIG00133285
Hit Family FunctionBeta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)


back to search