Query Sequence
>HSERO_RS07255
MQQAQFKKIGAVMILSLACAFSAQAQDKKPNVVVIGTGGTIAGAGASSVNTAAYQSAVVPVDKIIAAVPEISKIANVRGEQIFQIGSESFNDERLIKLGKRVSELLKQNDVDGIVITHGTDTIEETAYFLNLVLKSDKPVVVVGSMRPGTALGADGALNLYDAVLVAGSKEAAGKGTLVVMNDEIHSGRDVTKSNTFKVETFRSPYGPLGYVVENKLSFYRLPARPHTTQTEFDIDKISSLPRVDIVYNYGNVSRTAYDAFVAAGAKAIIHDGTGNGSVAEQIVPVLQEVRSKGVQVIRASRTGSGVVIRNGEQPDDKFDWVVTDDQNAQKARILAELALTKTNDPKELQKIMWKY
Hit FamilyFIG00000376
Hit Family FunctionL-asparaginase (EC 3.5.1.1)


back to search