Query Sequence
>HSERO_RS07175
MSTQFDNVTVLKKGNVYFDGKCVSHTVLFADGTKKTLGVILPASLTFNTGAPEIMEINGGSCRVRLKGEEAWNTYAAGTTFSVPGNSSFDIEVTETLDYVCHFG
Hit FamilyFIG00904518
Hit Family FunctionFIG074102: hypothetical protein


back to search