Query Sequence
>HSERO_RS05600
MSIHTSGALPTVHVDQVVEQGRFGAFQFGLLLLCGLCLIIDGFDVQAMGYVAPAIIADWGVSKASLGPVFGAGLFGMLLGSLVLTPVGDRYGRRPVLILSTLFFALCMLATPMVTTLDQLLVLRFITGFGLGSIMPNAMALVGEFSPSSSRVTRMMLVSCGFTVGAAAGGFVSAALIPAYGWHAVFWVGGAVPLVLGLAMLVWLPESIQFLVLHRRPRTQVARWLRKLDPNIVIDDKTEVVVKETKAEGMPVAALFRDGRAGVTVLLWLISFMNLINLYFLSNWLPTLIRDAGYSTSMAVLIGTSLQVGGVIGTLSLGRFIQRFGFTRVLGSCFLLACLSIALIGKLATVPALLFVAVIVAGFCIVGGQPAVNALAGTFYPTTLRSTGIGWALGIGRIGSVVGPVIGGQLIALQWTNASLFLAAAVPALISALTIARLHRTAQGVSA
Hit FamilyFIG00015882
Hit Family Function4-hydroxybenzoate transporter


back to search