Query Sequence
>HSERO_RS05485
MQQGLVIHAPHDLRIQALDTGALQPQQLKVKVKAGGICGSDLHYYHHGGFGVVRIKEPMVLGHEVSGQIAEVGTAVTDIAPGTRIAISPSRPCGACKYCQEGKQNHCLDMRFYGSAMRTPHVQGAFRQEIIIERSQAHVVADHVSDGEAAMAEPLSVALHAVRRAGPLVGKRVLVTGCGPIGALVVVAARRAGALEVVVTDVASMPLQAALQVGADSAINMAETPAALKAYAADKGTFDVLFEASGNERALVGALEALRPQAIIVQVGLGGDIQFPANLLVGKELEWRGAFRFHEEFAMAVELMNRKLVDVKPLITATYPIAQAVEAFEIAGDRSRMMKVQISFD
Hit FamilyFIG00003195
Hit Family FunctionL-idonate 5-dehydrogenase (EC 1.1.1.264)


back to search