Query Sequence
>HSERO_RS04810
MQSNDAENLMLAFGHFFPGAKEIGSWINGELVAGQGEIIQLYNPATGRASLSYRDGGAAAVEAAAVAAQRAQRQWWALSHAARGRALYAVGAVIRAEAEPLARLEAISSGKPIRDCRAEMQKVAEMFEYYAGWADKFYGEVIPVPSSHLNYTRREPYGTVLQMTPWNAPAFTCGWQLGPALATGNAVLLKPSELTPFSSLAIARLGEQAGLPAGLVNVLAGLGQTMVPQAMATWTVKKVIFVGSPATGALIAKAAAARVMPCVLELGGKSANIIFEDADLRLAAFGAQAAIFSGAGQSCVAGSRLLVQRKVYDRFVETVAAGAEKIRLGAPLDDSTEVGPINNRKQYEHIQRMVARGLEAGATLAAGHTRYGEEGYFVRPTLLAHASNAMEVARSEIFGPVAVAIPFEDEEEAIAIANDSEFGLAGAVWTRDVARAHRVAASVNAGTFWVNSYKTINVASPFGGFNRSGYGRSSGMEALYDYTQTKSVWVETSASPATPFGYAG
Hit FamilyFIG01292786
Hit Family FunctionAldehyde dehydrogenase (EC 1.2.1.3)


back to search