Query Sequence
>H281DRAFT_06484
MKMNWRNTAALALFATATATVTAGSAAAADIKEVRFGVEASYAPFESKSPSGELQGFDIDVGNAVCAKLKAKCVWVENSFDGLIPALQARKFNAINSDMTITDQRRQAVDFTDPIYTIPNQMIAKKGSGLLPTPASLKGKHVGVLQGTIQETYAKARWAPAGVDVVPYQTQDQIYADLASGRLDASFQDAEAASKGFLKKPQGAGFEFAGPAVSDEKLLGAGVGFGIRKGDAALKDALNQALKELKADGTIDRFAAKYFDVKVVLK
Hit FamilyFIG00046179
Hit Family FunctionLysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)


back to search