Query Sequence
>H281DRAFT_06327
MSEADNSTPNAGAFKPKKSVALSGVTAGNTALCTVGKTGNDLHYRGYDILDIAGNCEFEEIAYLLVHEKLPTQAELTAYKTKLKALRGLPANVKAALEWIPAAAHPMDVMRTGVSVLGTVLPEKDDHNLPGARDIADKLMASLGSMLLYWYHYSHNGKRIEVETDDDSIGGHFLHLLHGVEPSKSWVDAMHVSLNLYAEHEFNASTFTGRVIAGTGSDIYSAITGAIGALRGPKHGGANEVAFEIQSRYQTPDEAESDIRRRVENKEVVIGF
Hit FamilyFIG00001030
Hit Family Function2-methylcitrate synthase (EC 2.3.3.5)


back to search