Query Sequence
>H281DRAFT_06297
MKRRIFLTLAAAAAGVVFNAPVAQAADPVKIGFLVKQPEEPWFQDEWKFAEIAAKEKGFTLVKIGAPSGEKVMSAIDNLSAQKAQGFVICTPDVKLGPGIVAKAKADGLKMMTVDDRLVDGAGKPIASVPHMGISAYNIGKQVGDGLAAEIKKRGWDMKDVGAIDVTYEQLPTAHDRTSGATDALLAAGFPKANVIAAPQAKTDTENAFNAANIALTKNPQFKHWVAYALNDEGVLGAVRAAEGRGFKADNMIGIGIGGSDSALNEFKKPNPTGFFGTVIISPKRHGEETATLMYDWITQGKAPPPLTLTTGMLATRENVGEVREKMGLASK
Hit FamilyFIG00003299
Hit Family FunctionL-arabinose-binding periplasmic protein precursor AraF (TC 3.A.1.2.2)


back to search