Query Sequence
>H281DRAFT_05402
MVEFTLWDIARNLLLAARWTVLLSLIAFVGGGIVGLILLAMRVSPLPWLRRIVVLYVEVFQGTPLLMQLFLAFFGLPLLGVDVSPWVAATVTLTLYTSAYLVDIWRGCVEAVPRGQWAAGASLGMTFSQQLRYIVWPQALKIAVAPTVGFLVQVVKSTALASIIGFTELTKTGTMITNAAFRPFPIYGMVAMIYFAMCFPLTWYARVLEKRQKVGQHR
Hit FamilyFIG00050908
Hit Family FunctionGlutamate transport membrane-spanning protein


back to search