Query Sequence
>H281DRAFT_04542
MKSVCVYCGSANGAKPLYAKAARAFGRTLVEADLALVYGGGKVGLMGVIADTVMAEGGRAIGVIPELLVNKEVGHNGLTELHVVPDMHHRKKMMADLSDAFVAMPGGAGTLEELFEVYTWAQLGYHQKPVALLNIDGFYDPLINLLQHTVDEGFMRKAYLDILQIDADPGALIGKLQRYQPPAADKWAINRDAV
Hit FamilyFIG01349038
Hit Family FunctionLysine decarboxylase family


back to search