Query Sequence
>H281DRAFT_04143
MKHREEALALDSADPLATLRDQFALSATTIYLDGNSLGVPPAAAAQRAQTVIAAEWGEGLIRSWNAAGWFALPRRLGNKLAPLIGAAENEVVVTDTISINLFKLLSAALRLANARDPKRRVIVSERSNFPTDLYIAQGLIEQLDRGYDLRLVDDPSELPEAIGEDTAIAMITHVNYRTGYMHDMAALTRLIHDKGALALWDLAHSAGAVPVDLNGVGADYAVGCTYKYLNGGPGSPAFVWVPQRHQNDFAQPLSGWWGHRAPFKMDPAYQPDDGIGRFLCGTQPMVSMALVECGLDVFLQTDMQAIRRKSLALTDLFIELVETRCSEFPLKLVTPRAHSQRGSHASFEHPHGYEVMQALIARGVIGDYREPHVLRFGFTPLYTRFVDVWDAVETLREVLVRETWRAPEFAARGAVT
Hit FamilyFIG00001585
Hit Family FunctionKynureninase (EC 3.7.1.3)


back to search