Query Sequence
>H281DRAFT_04057
MNFNEYPIESLMYITNRPEIVFTHGKGSWLYDNNGKRYLDFIQGWAVNCLGHCDEGMIEALNQQAKLLFNPSPAFYNEPMAKLAALLTQHSCFDKVFFANSGAEANEGAIKLARKWGKKFKDGAFEIITFDHSFHGRTLATMSASGKPGWDTIYAPQVPGFPKADLNDIASVEKLINAKTVAVMLEPIQGEGGVIPATREFMQQLRELTRKHNVLLIVDEVQSGCGRAGTLFAYELSGVEPDIMTLGKGIGGGVPLAALLAKAEVAVFEAGDQGGTYNGNPLMTAVGYSVISQLTAPGFLEGVRARGEYLRAKLLELSEERGFKGERGEGLLRALLLGKDIGNQIVEKARDMQPDGLLLNAARPNLLRFMPALNVTNEEIDQMMAMLRSILDTL
Hit FamilyFIG00001168
Hit Family FunctionAcetylornithine aminotransferase (EC 2.6.1.11)


back to search